PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA07G05980.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 178aa    MW: 20640.6 Da    PI: 10.1077
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA07G05980.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-151460148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEde l + v+ +G   W+ Ia+ ++   t+kqc++rw ++l
  ONIVA07G05980.1 14 KGGWTREEDEVLRQMVRHHGDCKWTEIAKSLP-SQTGKQCRERWTNHL 60
                     688*****************************.************996 PP

2Myb_DNA-binding38.62.5e-1267105646
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +eE+ +l+++++ +G++ W++I r ++ gR+++ +k++w+ 
  ONIVA07G05980.1  67 EEEHMKLIEVHRTYGNR-WSAIVRWLP-GRSENTVKNHWNL 105
                      7****************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.803964IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-191360IPR009057Homeodomain-like
SMARTSM007171.1E-131362IPR001005SANT/Myb domain
SuperFamilySSF466897.03E-2714108IPR009057Homeodomain-like
PfamPF002499.4E-151460IPR001005SANT/Myb domain
CDDcd001672.09E-131760No hitNo description
CDDcd001672.00E-767107No hitNo description
PfamPF002492.1E-1067104IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-1267104IPR009057Homeodomain-like
PROSITE profilePS512948.46567111IPR017930Myb domain
SMARTSM007172.8E-567109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MQVAGSNDNL GLIKGGWTRE EDEVLRQMVR HHGDCKWTEI AKSLPSQTGK QCRERWTNHL  60
YSEIKIEEEH MKLIEVHRTY GNRWSAIVRW LPGRSENTVK NHWNLTKRSL NSKQRLRKKN  120
SEKAVPRQPS HLEEYICSFQ NPLLNETAPS PLAPPAPFDI VRYGTSRLIV VIPTPLVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29121125110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126151e-157CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankDQ9896281e-157DQ989628.1 Oryza sativa (indica cultivar-group) clone BAC 21O9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.18e-81PREDICTED: transcription factor RAX1-like
SwissprotQ9S7L23e-35MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A0E0HY661e-131A0A0E0HY66_ORYNI; Uncharacterized protein
STRINGLOC_Os07g12130.12e-80(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-36myb domain protein 98